Massively http://www.massively.com Massively http://www.blogsmithmedia.com/%SiteURL%/media/feedlogo.gif Massively http://www.massively.com en-us Copyright 2009 Weblogs, Inc. The contents of this feed are available for non-commercial use only. Blogsmith http://www.blogsmith.com/<![CDATA[MAG interview talks about gameplay and development]]>http://www.massively.com/2009/11/06/mag-interview-talks-about-gameplay-and-development/http://www.massively.com/2009/11/06/mag-interview-talks-about-gameplay-and-development/http://www.massively.com/2009/11/06/mag-interview-talks-about-gameplay-and-development/#commentsFiled under: , , , , , ,


You can argue the specifics about whether or not MAG qualifies as an MMO, but the game certainly fits the "massive" portion of the bill -- 128 characters to a side in battle, customized and developed characters, persistent world based on the performance in the skirmishes. The game's release is only a couple months away, and there's still a great deal more to learn about it if you haven't yet opted in to the preorder beta. Luckily for all of us, Giant Bomb has an interview with Seth Luisi which sheds more light on how the game will play and progress.

The interview is quite substantial, covering everything from MAG's skill progression to leadership roles in the game. Among the more interesting tidbits is the system for squad leaders and further command posts. In order to give some incentive to follow a commander's orders, the objectives they set give a bonus to experience when fulfilled, and as the objectives are fulfilled the leader gets points to help improve their character. It's an interesting dual-reward system that should help lead to people being a bit more inclined to give and take orders in a setting notorious for just the opposite.

But that's hardly the entirety of the interview -- it's only a tiny slice of a talk that ranges to the state of the world affecting map play, character specialization, and some of the problems that the team is facing and working on improving. Take a look at the full interview, which clocks in at around eight minutes long, and you might be inspired to place a pre-order and get your hands on the beta early.

MassivelyMAG interview talks about gameplay and development originally appeared on Massively on Fri, 06 Nov 2009 09:00:00 EST. Please see our terms for use of feeds.

Read | Permalink | Email this | Comments]]>betabetasfpsgame-mechanicsinterviewsleadershipmagmmofpsnew-titlespersistenceseth-luisiFri, 06 Nov 2009 09:00:00 EST<![CDATA[DDO: Unlimited Shan-to-Kor adventure pack trailer]]>http://www.massively.com/2009/11/04/ddo-unlimited-shan-to-kor-adventure-pack-trailer/http://www.massively.com/2009/11/04/ddo-unlimited-shan-to-kor-adventure-pack-trailer/http://www.massively.com/2009/11/04/ddo-unlimited-shan-to-kor-adventure-pack-trailer/#commentsFiled under: , ,

Turbine has released a video for the Shan-to-Kor adventure pack, which is aimed at level four and above players. The dungeon -- which lies deep beneath the marketplace -- is nothing too grandiose or epic, certainly not on the level of Dol Guldur, but these videos serve as a nice way for interested DDO: Unlimited players to get a preview of content before they commit to buying it in-game through the DDO Store.

We wonder if there's a way for Turbine to incorporate these videos into the actual game itself, or at the very least to offer an external link for easy viewing. That may be asking too much, although since they keep making these it seems pretty logical to us.

Check out the video after the break.

Continue reading DDO: Unlimited Shan-to-Kor adventure pack trailer

MassivelyDDO: Unlimited Shan-to-Kor adventure pack trailer originally appeared on Massively on Wed, 04 Nov 2009 15:00:00 EST. Please see our terms for use of feeds.

Read | Permalink | Email this | Comments]]>adventure-packddoddo-unlimitedshan-to-korturbinevideoWed, 04 Nov 2009 15:00:00 EST<![CDATA[New Star Trek Online gameplay trailer]]>http://www.massively.com/2009/11/04/new-star-trek-online-gameplay-trailer/http://www.massively.com/2009/11/04/new-star-trek-online-gameplay-trailer/http://www.massively.com/2009/11/04/new-star-trek-online-gameplay-trailer/#commentsFiled under: , ,


There's a new Star Trek Online trailer out from Cryptic, originally released through GameSpot. The trailer features some impressive gameplay footage that illustrates nicely a few aspects of STO we've been hearing about for a while.

There's both ground combat and space combat featured, with Klingon, Federation, and Borg ships taking part in the overall action. In one scene we see a fleet of ships attacking a single Borg cube in quite a nice display of firepower, including several (of what appear to be) quantum torpedoes.

One of the more impressive aspects of this gameplay footage that we picked up on right way was the tactical maneuvering of what appears to be a mid-range ship of Romulan design. A captured still of the scene is pictured above, and you can clearly see in the video that the ship is moving to direct hits against its "bottom side" after the port shields were taking a significant beating. Note that the two ships attacking the main ship with green phasers are Klingon Vor'Cha class, so we're assuming the ship demonstrating the tactical moves is of Romulan origin.

We also noticed that the ship pictured above bares some resemblance to the unidentified "classified" ship listed in the Ships of the Line articles at the official STO website. The above ship can be viewed more clearly in the HD trailer, however the unidentified ship on the STO website doesn't have a clear image -- only a blurry reconnaissance image. The warp nacelles both look similar (espeically if you take the image angles into consideration), both have the same general outline, and both have guns protruding from each wing. An interesting coincidence we wanted to point out.

The video after the break.

Continue reading New Star Trek Online gameplay trailer

MassivelyNew Star Trek Online gameplay trailer originally appeared on Massively on Wed, 04 Nov 2009 11:00:00 EST. Please see our terms for use of feeds.

Read | Permalink | Email this | Comments]]>borgborg-shipbreakingcrypticcryptic-studiosfederationgamespotklingonstar-trek-online-gameplaystosto-borgsto-gameplaysto-klingonsto-tactical-movessto-trailertacticalWed, 04 Nov 2009 11:00:00 EST<![CDATA[Demo impressions of Star Trek Online from Eurogamer Expo 2009]]>http://www.massively.com/2009/11/02/demo-impressions-of-star-trek-online-from-eurogamer-expo-2009/http://www.massively.com/2009/11/02/demo-impressions-of-star-trek-online-from-eurogamer-expo-2009/http://www.massively.com/2009/11/02/demo-impressions-of-star-trek-online-from-eurogamer-expo-2009/#commentsFiled under: , , , , ,


We recently mentioned that Star Trek Online fans would get a chance to play through a demo of the game at Eurogamer Expo last week. One of the first reports we've read about the Star Trek Online demo comes from Oli Welsh at Eurogamer who was uniquely positioned to check out the game (it was their Expo after all.) Welsh begins by writing, "Trekkies can put one fear to rest right now: Star Trek Online feels just like Star Trek." Although this might assuage a bit of the apprehension some gamers have about trying yet another Star Trek game, Welsh is up front about the fact that the demo he played through was a contained single player experience. It's too soon to say what gameplay will feel like when hundreds of other players are thrown into the mix.

He writes about the demo's transitions between locations via warp jumps, keyboard navigation of star ships (standard WASD, with additional throttle control), and the pacing of ship combat. Welsh also walks the reader from the bridge of a Federation vessel down to the surface of a planet where Klingon opponents await. Fans of the game should read Eurogamer's hands on with Star Trek Online and may also be interested in the video footage of STO gameplay from Limited Edition, shot at this year's Eurogamer Expo (starting at 02:40. They've also captured gameplay of Global Agenda as well.) We've got a video embed of that for you after the jump.

Continue reading Demo impressions of Star Trek Online from Eurogamer Expo 2009

MassivelyDemo impressions of Star Trek Online from Eurogamer Expo 2009 originally appeared on Massively on Mon, 02 Nov 2009 17:00:00 EST. Please see our terms for use of feeds.

Read | Permalink | Email this | Comments]]>combatcrypticcryptic-studiosdemoeurogamereurogamer-expoeurogamer-expo-2009federationgameplayglobal-agendahands-onjohn-nicholsonklingonlimited-editionnew-titlesoli-welshpvequestssci-fishuttlerstar-trekstar-trek-onlinestovideoMon, 02 Nov 2009 17:00:00 EST<![CDATA[A video guide to the Second Life Terms of Service]]>http://www.massively.com/2009/11/02/a-video-guide-to-the-second-life-terms-of-service/http://www.massively.com/2009/11/02/a-video-guide-to-the-second-life-terms-of-service/http://www.massively.com/2009/11/02/a-video-guide-to-the-second-life-terms-of-service/#commentsFiled under: , , , , ,

'I cannot read the fiery letters,' said Frodo in a quavering voice.

'No,' said Gandalf, 'but I can. The letters are English, of an ancient mode, but the language is that of Lawyers, which I will not utter here. But this in the Common Tongue is what is said, close enough:

'You agree to review and adhere to the guidelines on using "Second Life," "SL," "Linden," the Eye-in-Hand logo, and Linden Lab's other trademarks, service marks, trade names, logos, domain names, taglines, and trade dress..'

He paused, and then said slowly in a deep voice: 'These are the Master Rules, the Terms of Service that rule all accounts.'

Well, a joint-project of Rhys Moult with Curtin University and the Tabor Adelaide iYouth Project has produced a video which essentially summarizes the 7,500 word Second Life Terms of Service in a straightforward and easy-to-digest form. It's top work, and you can check it out, after the fold.

Continue reading A video guide to the Second Life Terms of Service

MassivelyA video guide to the Second Life Terms of Service originally appeared on Massively on Mon, 02 Nov 2009 11:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>academicadelaideaustraliacurtin-universityguidesmachinimarhys-moultsecond-lifesl-tostabor-adelaide-iyouth-projectterms-of-servicevideovirtual-worldsMon, 02 Nov 2009 11:00:00 EST<![CDATA[GameX 2009: Inside Global Agenda's PvE and AvA persistent content battles]]>http://www.massively.com/2009/10/30/gamex-2009-inside-global-agendas-pve-and-ava-persistent-conten/http://www.massively.com/2009/10/30/gamex-2009-inside-global-agendas-pve-and-ava-persistent-conten/http://www.massively.com/2009/10/30/gamex-2009-inside-global-agendas-pve-and-ava-persistent-conten/#commentsFiled under: , , , , , , , , , , ,


As we've said before, we got to see many, many people at GameX 2009 this year. But one of the main reasons we went to the expo was to catch up once again with the team from Hi-Rez Studios and ask them some more questions on their "spy-fi" MMOFPS, Global Agenda.

On the top of our burning question list was what exactly made Global Agenda into an MMO, so we set out to ask associate producer Michal Adam all about what made their AvA and persistent world battles so special. Along the way, we also inquired as to what their PvE content will hold, and what rewards players could expect to find from participating in Global Agenda: Conquest.

For our full video interview with Michal, look no further than after the break!

Continue reading GameX 2009: Inside Global Agenda's PvE and AvA persistent content battles

MassivelyGameX 2009: Inside Global Agenda's PvE and AvA persistent content battles originally appeared on Massively on Fri, 30 Oct 2009 18:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>alliance-vs-allianceavafeaturedgamexgamex-2009global-agendamichal-adammmofpspersistent-worldpvepvpspy-fiFri, 30 Oct 2009 18:00:00 EST<![CDATA[GameX 2009: 1.3.2 decision making, streaming client, and unlimited trials for Warhammer Online]]>http://www.massively.com/2009/10/30/gamex-2009-1-3-2-decision-making-streaming-client-and-unlimit/http://www.massively.com/2009/10/30/gamex-2009-1-3-2-decision-making-streaming-client-and-unlimit/http://www.massively.com/2009/10/30/gamex-2009-1-3-2-decision-making-streaming-client-and-unlimit/#commentsFiled under: , , , , , , , ,


We saw the Warhammer Online booth at GameX, and we wagggggghed ourselves right into a video interview with James Casey and Matt Shaw from Mythic Entertainment that pulled no punches. We wanted to know what was going on behind the scenes with their decision making in patch 1.3.2, shooting James and Matt the hard questions.

Why were fortresses pulled from the endgame? Why choose 1.3.2 for performance fixes and not fix these things earlier? While we interrogated, Matt and James were also happy to tell us about the new stuff for WAR, including the new-user experience added in 1.3.2, the awesome unlimited trial that starts today, and the new streaming client option that trial users will receive.

So for the answers to some burning WAR questions, jump with us after the break and check out our video interview!

Continue reading GameX 2009: 1.3.2 decision making, streaming client, and unlimited trials for Warhammer Online

MassivelyGameX 2009: 1.3.2 decision making, streaming client, and unlimited trials for Warhammer Online originally appeared on Massively on Fri, 30 Oct 2009 17:30:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>1.3.2ea-mythicfortressesgamexgamex-2009james-caseymatt-shawmythicmythic-entertainmentperformance-fixesstreaming-clientunlimited-trialwarwarhammerwarhammer-onlineFri, 30 Oct 2009 17:30:00 EST<![CDATA[EVE's planetary graphics kicked up yet another notch for Dominion expansion]]>http://www.massively.com/2009/10/29/eves-planetary-graphics-kicked-up-yet-another-notch-for-dominio/http://www.massively.com/2009/10/29/eves-planetary-graphics-kicked-up-yet-another-notch-for-dominio/http://www.massively.com/2009/10/29/eves-planetary-graphics-kicked-up-yet-another-notch-for-dominio/#commentsFiled under: , , ,


We pointed out last month that EVE Online will get a new look to its planets this December, when the Dominion expansion launches. There's now more footage of the improved planetary graphics which is even better than what we saw in September, with a closer look at the swirling clouds, continents, and oceans, as well as light and shadows on the horizon. The footage is courtesy once again of EVE Online player Flamewave -- who may just live on the Singularity test server.

We've got a video embed of Flamewave's footage of the new planetary graphics as seen on the test server, so stick with us after the jump for a stunning look at New Eden as it will appear in Dominion.

Continue reading EVE's planetary graphics kicked up yet another notch for Dominion expansion

MassivelyEVE's planetary graphics kicked up yet another notch for Dominion expansion originally appeared on Massively on Thu, 29 Oct 2009 11:00:00 EST. Please see our terms for use of feeds.

Read | Permalink | Email this | Comments]]>ccpccp-gamescloudsdominioneveeve-onlineexpansionsflamewavegraphicsnew-edenplanetssci-fisingularitytest-servervideoThu, 29 Oct 2009 11:00:00 EST<![CDATA[GameX 2009: Victorian spaceships with Ben "Yahtzee" Croshaw]]>http://www.massively.com/2009/10/28/gamex-2009-victorian-spaceships-with-ben-yahtzee-croshaw/http://www.massively.com/2009/10/28/gamex-2009-victorian-spaceships-with-ben-yahtzee-croshaw/http://www.massively.com/2009/10/28/gamex-2009-victorian-spaceships-with-ben-yahtzee-croshaw/#commentsFiled under: , , , , ,

Ben "Yahtzee" Croshaw of the infamous Zero Punctuation reviews on The Escapist is a bit tricky to track down, but we were able to get some time in with him at this year's GameX in Philadelphia.

We pitched the fast talking reviewer some questions to get his opinion on the MMO genre beyond his reviews of Tabula Rasa and EVE Online, and found out some interesting things -- like victorian steampunk spaceships are awesome. So what breaks the MMO genre for Yahtzee? Will more MMOs be smash... er... featured on Zero Punctuation? If you're wondering the answers to these questions, then wonder no more! Just click on through after the break to check out our video interview!

Continue reading GameX 2009: Victorian spaceships with Ben "Yahtzee" Croshaw

MassivelyGameX 2009: Victorian spaceships with Ben "Yahtzee" Croshaw originally appeared on Massively on Wed, 28 Oct 2009 17:30:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>ben-croshawben-yahtzee-croshawfeaturedgamexgamex-2009interviewmmosopinionthe-escapistvideo-interviewyahtzeeyahtzee-croshawzero-punctuationWed, 28 Oct 2009 17:30:00 EST<![CDATA[GameX 2009: Massively talks with Lee Hammock on what's next for Fallen Earth]]>http://www.massively.com/2009/10/28/gamex-2009-massively-talks-with-lee-hammock-on-whats-next-for/http://www.massively.com/2009/10/28/gamex-2009-massively-talks-with-lee-hammock-on-whats-next-for/http://www.massively.com/2009/10/28/gamex-2009-massively-talks-with-lee-hammock-on-whats-next-for/#commentsFiled under: , , , , , , ,

Content, community, and epic beards ahead fair readers! When lead game designer Lee Hammock walked into the media room at GameX 2009, we immediately tackled him into a chair and demanded he answer our many questions on what's coming up for Fallen Earth. What we got (after he figured out that we wanted to interview him and not kidnap him) were answers on the upcoming "social" patch for Fallen Earth, a look at the brand new crafting skill, construction, and the camps that will be added to the game, what lies beyond Sector 3 (hint: it's Sector 4) and how much the team loves their community.

So if you're interested in Fallen Earth, or are looking for a reason to get into the game, look no further than the interview that lies beyond the break! Unfortunately though, we must make a slight correction to what Lee says in the interview. Fallen Earth did send us 2,000 trial keys, but thanks to an overwhelming response, we're out of keys! This makes us sad pandas, but you can still enjoy what Lee has to say about the game, and be amazed by the hypnotic beard.

Continue reading GameX 2009: Massively talks with Lee Hammock on what's next for Fallen Earth

MassivelyGameX 2009: Massively talks with Lee Hammock on what's next for Fallen Earth originally appeared on Massively on Wed, 28 Oct 2009 16:30:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>campsconstructionfallen-earthfeaturedfree-trialgame-expogamexgamex-2009interviewlee-hammocksector-4social-patchvideo-interviewWed, 28 Oct 2009 16:30:00 EST<![CDATA[Get up to date with Star Trek Online's Future Past video two]]>http://www.massively.com/2009/10/28/get-up-to-date-with-star-trek-onlines-future-past-video-two/http://www.massively.com/2009/10/28/get-up-to-date-with-star-trek-onlines-future-past-video-two/http://www.massively.com/2009/10/28/get-up-to-date-with-star-trek-onlines-future-past-video-two/#commentsFiled under: , , ,


Star Trek Online's the Future Past part two video brings us up to speed on everything that's led up to the open conflict between the Federation and Klingon Empire in the year 2409. It details the events that brought the Gorn into the Klingon Empire, as well as the initial attack that led to actual war between what will be the two player factions when the game launches.

While they may not be as crazy and over-the-top as other videos we've recently seen, these lore pieces are more than welcome. This is probably the last of the lore videos, and we imagine from here on out Cryptic will be releasing more game feature orientated stuff -- so enjoy this while you can, lore nerds.

Check out the lore-filled video after the break.

Continue reading Get up to date with Star Trek Online's Future Past video two

MassivelyGet up to date with Star Trek Online's Future Past video two originally appeared on Massively on Wed, 28 Oct 2009 08:00:00 EST. Please see our terms for use of feeds.

Read | Permalink | Email this | Comments]]>ataricrypticcryptic-studiosfuture-pastlorestar-trekstar-trek-onlinestovideoWed, 28 Oct 2009 08:00:00 EST<![CDATA[GameX 2009: Massively.com talks with The Guild]]>http://www.massively.com/2009/10/26/gamex-2009-massively-com-talks-with-the-guild/http://www.massively.com/2009/10/26/gamex-2009-massively-com-talks-with-the-guild/http://www.massively.com/2009/10/26/gamex-2009-massively-com-talks-with-the-guild/#commentsFiled under: , , ,


GameX 2009 was insane this weekend and we were all over the place, but one of the first groups that we set a chunk of time aside for was Jeff Lewis (Vork), Sandeep Parikh (Zaboo), and Robin Thorsen (Clara) from The Guild. We weren't missing out on catching up with those three.

The interview that ensued answered some of the important questions in life, like how many MMO real life experiences get moved into The Guild's script, what it was like to work with Wil Wheaton and Jed Whedon, and is that a real Sandeep Parikh Backflip (TM) in the "Do You Wanna Date My Avatar" music video?

If you're curious to these answers and more, then you should click that button below and continue reading after the break. We have an exclusive video interview for you!

Continue reading GameX 2009: Massively.com talks with The Guild

MassivelyGameX 2009: Massively.com talks with The Guild originally appeared on Massively on Mon, 26 Oct 2009 19:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>backflipdo-you-wanna-date-my-avatarfeaturedgame-expogamexgamex-2009jed-whedonjeff-lewisphiladelphiarobin-thorsensandeep-parikhthe-guildvideovideo-interviewwil-wheatonMon, 26 Oct 2009 19:00:00 EST<![CDATA[Star Trek Online cinematic war trailer shows off combat footage]]>http://www.massively.com/2009/10/26/star-trek-online-cinematic-war-trailer-shows-off-combat-footage/http://www.massively.com/2009/10/26/star-trek-online-cinematic-war-trailer-shows-off-combat-footage/http://www.massively.com/2009/10/26/star-trek-online-cinematic-war-trailer-shows-off-combat-footage/#commentsFiled under: , , , ,


The next major MMO from Cryptic Studios is Star Trek Online, which may bridge the gap in sci-fi MMOs between ship-based combat and avatar interaction on planetary surfaces. Cryptic has been releasing new screenshots and talking quite a bit about character progression lately, but sometimes it's better to show than to tell. That's what they're doing with the latest game trailer showing off footage of conflicts in space and planetary environments your away teams will explore.

The Star Trek Online cinematic war trailer at GameVideos gives some background on the STO setting along with the requisite phaser fire, Borg cubes, and bridges boarded. We've got the latest Star Trek Online footage embedded for you, so stick with us after the cut.

Continue reading Star Trek Online cinematic war trailer shows off combat footage

MassivelyStar Trek Online cinematic war trailer shows off combat footage originally appeared on Massively on Mon, 26 Oct 2009 16:00:00 EST. Please see our terms for use of feeds.

Read | Permalink | Email this | Comments]]>combatcrypticcryptic-studiosenvironmentsgamevideosnew-titlessci-fistar-trekstar-trek-onlinestotrailersvideoMon, 26 Oct 2009 16:00:00 EST<![CDATA[DDO releases Gianthold adventure pack video]]>http://www.massively.com/2009/10/23/ddo-releases-gianthold-adventure-pack-video/http://www.massively.com/2009/10/23/ddo-releases-gianthold-adventure-pack-video/http://www.massively.com/2009/10/23/ddo-releases-gianthold-adventure-pack-video/#commentsFiled under: , , , ,

Since Turbine switched Dungeons and Dragons Online to a free-to-play model, the game has enjoyed a huge surge in popularity. They're keeping up nicely with the large new player base, offering over 20 adventure packs for all different levels in addition to the main game content.

Earlier this week DDO released a video of one of the newest adventure packs, Ruins of Gianthold. "The Stormreaver plots to destroy Stormreach and fulfill an ancient prophecy! Earn the trust of the Gianthold army and confront the Stormreaver and his dragon lieutenants."

This one is a bit more advanced than some others, designed for level 13-14 players, and contains a generous amount of content: 10 adventures, 45 quests and a raid. Like the other adventure packs, you can find it in the DDO Store. Follow along after the jump for a look at the video, or check it out on Turbine's official YouTube channel.

Continue reading DDO releases Gianthold adventure pack video

MassivelyDDO releases Gianthold adventure pack video originally appeared on Massively on Fri, 23 Oct 2009 19:00:00 EST. Please see our terms for use of feeds.

Read | Permalink | Email this | Comments]]>adventure-packddodungeons-and-dragons-onlinef2pturbineyoutubeFri, 23 Oct 2009 19:00:00 EST<![CDATA[Free Realms video answers player questions about Halloween update]]>http://www.massively.com/2009/10/22/free-realms-video-answers-player-questions-about-halloween-updat/http://www.massively.com/2009/10/22/free-realms-video-answers-player-questions-about-halloween-updat/http://www.massively.com/2009/10/22/free-realms-video-answers-player-questions-about-halloween-updat/#commentsFiled under: , , , , , ,


We're noting that there's a slew of Halloween events happening in the MMO world this month, and it comes as no surprise that Free Realms is getting in on the fun as well with a "Super Spooktacular" Halloween update. This is the topic of the latest "Ask a Dev" video with Associate Game Designer Julie Burness and Lead Character Artist Matt Case. The Q&A is done in costume, with questions from the players themselves on the Free Realms forums.

The Free Realms devs discuss the new content which includes Halloween themed quests, werewolf and dinosaur costumes, and all kinds of holiday items -- like candy that turns players into... something else. There's going to be trick-or-treating in Free Realms as well, where players will have to scare others to get treats.

We've got the video for you, so stick with us after the jump for the Free Realms "Ask a Dev" devoted to the Super Spooktacular Halloween update.

Continue reading Free Realms video answers player questions about Halloween update

MassivelyFree Realms video answers player questions about Halloween update originally appeared on Massively on Thu, 22 Oct 2009 19:30:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>ask-a-devcandycasualcostumeseventsfantasyfree-realmshalloweenhalloween-costumesholiday-questsinterviewsjulie-burnesskidsmatt-casequestssoesony-online-entertainmentsuper-spooktacularvideoThu, 22 Oct 2009 19:30:00 EST<![CDATA[Venture Beat visits Cryptic to see Star Trek Online]]>http://www.massively.com/2009/10/18/venture-beat-visits-cryptic-to-see-star-trek-online/http://www.massively.com/2009/10/18/venture-beat-visits-cryptic-to-see-star-trek-online/http://www.massively.com/2009/10/18/venture-beat-visits-cryptic-to-see-star-trek-online/#commentsFiled under: , , ,


It's no secret that while Cryptic Studios has done well for themselves over the years, Star Trek Online is easily their biggest project yet. In fact, if successful, this game will easily attract a large amount of people who probably wouldn't otherwise look at an MMO, let alone purchase and subscribe to one.

With this in mind, it's no surprise that Venture Beat's Dean Takahashi visited the developer for the skinny on everything to do with both the game and the company behind it. The videos and feature are more of a probing look into the people working on the beloved franchise's foray into massively multiplayer online gaming space than a preview on the actual game itself -- and we're all the richer for that. Getting a look at the heart and soul of the people behind any game is supremely refreshing.

Check out the video coverage from Venture Beat after the break.

Continue reading Venture Beat visits Cryptic to see Star Trek Online

MassivelyVenture Beat visits Cryptic to see Star Trek Online originally appeared on Massively on Sun, 18 Oct 2009 10:00:00 EST. Please see our terms for use of feeds.

Read | Permalink | Email this | Comments]]>ataricrypticcryptic-studiosdean-takahashistar-trekstar-trek-onlinestoventure-beatSun, 18 Oct 2009 10:00:00 EST<![CDATA[Klingons make their first Star Trek Online video appearance]]>http://www.massively.com/2009/10/17/klingons-make-their-first-star-trek-online-video-appearance/http://www.massively.com/2009/10/17/klingons-make-their-first-star-trek-online-video-appearance/http://www.massively.com/2009/10/17/klingons-make-their-first-star-trek-online-video-appearance/#commentsFiled under: , , ,


Just when you thought you'd seen enough Star Trek Online space combat videos to keep you satisfied for a day or two, Cryptic Studios whips out a Klingon focused trailer that's sure to get your Pepto Bismol colored blood beating through those hardened, warrior-like veins.

That's right, Klingons are in this game! We almost forgot with all that Federation love coming from Cryptic ever since the game was announced. But that's okay, because Klingon's are accustomed to waiting in secrecy for the right moment to strike. This is only the first small disruptor blast in what's sure to be a volley of ferocious strikes far greater than any puny Federation ship could handle.

See the glory of the Klingon Empire after the break.

Continue reading Klingons make their first Star Trek Online video appearance

MassivelyKlingons make their first Star Trek Online video appearance originally appeared on Massively on Sat, 17 Oct 2009 16:00:00 EST. Please see our terms for use of feeds.

Read | Permalink | Email this | Comments]]>ataricombatcrypticcryptic-studiosdisruptorfederationignklingonklingon-empireklingonspepto-bismolspacestar-trek-onlinestotrailervideoSat, 17 Oct 2009 16:00:00 EST<![CDATA[Blogger to play 24 hours of MMOs for charity]]>http://www.massively.com/2009/10/17/blogger-plays-games-and-heals-kids/http://www.massively.com/2009/10/17/blogger-plays-games-and-heals-kids/http://www.massively.com/2009/10/17/blogger-plays-games-and-heals-kids/#commentsFiled under: , , ,

Beau Turkey, the guy-half of the Spouse Aggro blog and podcast -- and a regular guest on our own Massively Speaking podcast -- is participating in a very special charity event all day today. The charity is called Extra Life, and it is a 24-hour gaming marathon with the slogan "Play games, heal kids", created to raise money for the Texas Children's Cancer Center.

Beau has chosen his games -- twelve games for two hours each -- and posted his list here. He's included in-game names and servers for each game to make it easier for those who'd like to join him. If you're more of a voyeur, Beau has been kind enough to set up live streaming video of the event as well. We're predicting that it's going to be pretty fun to watch, especially around hour eighteen or so, when he starts to lose feeling in his right hand.

Of course, it's good if you want to watch; better if you log in and play with Beau, and best if you donate. Beau's goal is a pretty reasonable $192.00, and you can help him reach it here. Good luck Beau, we think you're doing a great thing. Hope you have plenty of coffee on-hand!

MassivelyBlogger to play 24 hours of MMOs for charity originally appeared on Massively on Sat, 17 Oct 2009 09:00:00 EST. Please see our terms for use of feeds.

Read | Permalink | Email this | Comments]]>beau-turkeycharitiescharityextra-lifesarcastic-gamerspouse-aggrostreaming-videoSat, 17 Oct 2009 09:00:00 EST<![CDATA[Exclusive video of Mage class in Dungeon Fighter Online]]>http://www.massively.com/2009/10/16/exclusive-video-of-mage-class-in-dungeon-fighter-online/http://www.massively.com/2009/10/16/exclusive-video-of-mage-class-in-dungeon-fighter-online/http://www.massively.com/2009/10/16/exclusive-video-of-mage-class-in-dungeon-fighter-online/#commentsFiled under: , , , , , , ,


The team over at Nexon has given us a look at the Mage class from their new 2D dungeon crawling brawler, Dungeon Fighter Online, and boy does she pack a punch!

Hard hitting magical spells define this class, of course, but that's not all she can accomplish. The class also has some monster controlling abilities, like gravity wells and knockbacks, in addition to their elemental area of effect spells. If that wasn't enough, the mage can also summon elemental pets, making her the "stand back and let something else beat it" class of the game.

Of course, you shouldn't take our word on this alone. We have this fancy exclusive video of the mage exploding people! Hit the continue reading, and let your eyes absorb all of the tasty monster destruction.

Continue reading Exclusive video of Mage class in Dungeon Fighter Online

MassivelyExclusive video of Mage class in Dungeon Fighter Online originally appeared on Massively on Fri, 16 Oct 2009 18:30:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>2ddfodungeon-crawldungeon-fighter-onlinemagemage-gameplaynexontrailervideoFri, 16 Oct 2009 18:30:00 EST<![CDATA[All Points Bulletin podcast #12 delivers community Q&A]]>http://www.massively.com/2009/10/16/all-points-bulletin-podcast-12-delivers-community-qanda/http://www.massively.com/2009/10/16/all-points-bulletin-podcast-12-delivers-community-qanda/http://www.massively.com/2009/10/16/all-points-bulletin-podcast-12-delivers-community-qanda/#commentsFiled under: , , ,


All Points Bulletin's 12th video podcast sees the conclusion of the Mark Rein walkthrough and an informative Q&A with the game's design lead, EJ Moreland. Some of the questions are things we already knew but bore repeating, like that the game is going to be PC only for its first release.

There's new information in there, too. Like the fact that a car you design cannot be stolen from you while driving it, unlike a car you steal from a pedestrian. There's also talk about player and clan housing as future additions to the game.

We think the video podcasts are a great way to clear the air of any misconceptions while simultaneously giving the community a chance to meet the people designing the game they so very much want to play. So hopefully we'll be seeing more of these in the coming weeks leading up to wider beta and eventually, launch.

Check out the video after the break.

Continue reading All Points Bulletin podcast #12 delivers community Q&A

MassivelyAll Points Bulletin podcast #12 delivers community Q&A originally appeared on Massively on Fri, 16 Oct 2009 13:00:00 EST. Please see our terms for use of feeds.

Read | Permalink | Email this | Comments]]>all-points-bulletinapbclan-housingea-partnersej-morelandguild-housingmark-reinplayer-housingpodcastrealtime-worldsvideo-podcastFri, 16 Oct 2009 13:00:00 EST